PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00136.1_g00021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 320aa    MW: 36584.1 Da    PI: 8.2091
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00136.1_g00021.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.9e-54101361129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL kkv + ++++  +i +vd++k+ePw+Lp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkat
  Sme2.5_00136.1_g00021.1  10 LPPGFRFHPTDEELITHYLSKKVVDANFSA-IAIGDVDMNKIEPWELPWKAKIGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKAT 94 
                              79*************************999.88***************98999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ +++lvg+kktLvfykgrap+gekt+Wv heyrle
  Sme2.5_00136.1_g00021.1  95 GKDKEIFR-GRSLVGMKKTLVFYKGRAPRGEKTNWVTHEYRLE 136
                              ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-615160IPR003441NAC domain
PROSITE profilePS5100558.14410160IPR003441NAC domain
PfamPF023656.7E-2811135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MDDQQQQMEL PPGFRFHPTD EELITHYLSK KVVDANFSAI AIGDVDMNKI EPWELPWKAK  60
IGEKEWYFFC VRDKKYPTGL RTNRATAAGY WKATGKDKEI FRGRSLVGMK KTLVFYKGRA  120
PRGEKTNWVT HEYRLEGRLS LQNLPKTVKN DWVICRVFQK TTGGKKIHIS GLVRGNSDEN  180
ETGNSHSLLP PLTDSSPSHV HCFSNYVTAQ KNQESNMINS FNTCPNFSIL SNSNDIFQRN  240
SLPNAFTWNQ TVPLQHNFPQ PGSFPLQDPA TLRNLLENYG QQSFKKETDI ISASQETGIS  300
TDMNTEITSA QQDLDCFWTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-55316610171NO APICAL MERISTEM PROTEIN
1ut4_B4e-55316610171NO APICAL MERISTEM PROTEIN
1ut7_A4e-55316610171NO APICAL MERISTEM PROTEIN
1ut7_B4e-55316610171NO APICAL MERISTEM PROTEIN
3swm_A4e-55316613174NAC domain-containing protein 19
3swm_B4e-55316613174NAC domain-containing protein 19
3swm_C4e-55316613174NAC domain-containing protein 19
3swm_D4e-55316613174NAC domain-containing protein 19
3swp_A4e-55316613174NAC domain-containing protein 19
3swp_B4e-55316613174NAC domain-containing protein 19
3swp_C4e-55316613174NAC domain-containing protein 19
3swp_D4e-55316613174NAC domain-containing protein 19
4dul_A4e-55316610171NAC domain-containing protein 19
4dul_B4e-55316610171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755151e-175HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001308203.10.0NAC domain-containing protein
SwissprotQ9FLJ21e-123NC100_ARATH; NAC domain-containing protein 100
TrEMBLK4BL870.0K4BL87_SOLLC; Uncharacterized protein
STRINGSolyc03g115850.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-117NAC domain containing protein 100